Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
-Immunohistochemistry-Paraffin-NBP3-07273-img0001.jpg-650.jpg)
GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™
Mouse Monoclonal Antibody
$265.00
Specifications
| Antigen | GDF-9 |
|---|---|
| Clone | GDF9/4261 |
| Concentration | 0.2 mg/ml |
| Dilution | Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml |
| Applications | Western Blot, ELISA, Immunohistochemistry (Paraffin) |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB122020
|
Novus Biologicals
NBP30727320UG |
20 μg |
Each of 1 for $265.00
|
|
|||||
Description
GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry-Paraffin.Specifications
| GDF-9 | |
| 0.2 mg/ml | |
| Western Blot, ELISA, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Cytokine Research | |
| 10 mM PBS with 0.05% BSA | |
| 2661 | |
| IgG1 | |
| Protein A or G purified |
| GDF9/4261 | |
| Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
| Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. | |
| Primary | |
| Store at 4°C. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title