Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™

Mouse Monoclonal Antibody

$138.37 - $352.89

Specifications

Antigen GDF-9
Clone GDF9/4261
Concentration 0.2 mg/ml
Dilution Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml
Applications Western Blot, ELISA, Immunohistochemistry (Paraffin)
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB122019
View Documents
Novus Biologicals
NBP30727310UG
100 μg
Each for $352.89
Add to cart
 
NB122020
View Documents
Novus Biologicals
NBP30727320UG
20 μg
Each for $138.37
Add to cart
 
Description

Description

GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry (Paraffin)
Specifications

Specifications

GDF-9
0.2 mg/ml
Western Blot, ELISA, Immunohistochemistry (Paraffin)
Purified
RUO
Human
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9.
Monoclonal
Protein A or G purified
GDF9/4261
Western Blot 1-2 ug/ml, ELISA, Immunohistochemistry-Paraffin 1-2 ug/ml
Unconjugated
Mouse
Cytokine Research
10 mM PBS with 0.05% BSA
2661
IgG1
Primary
Store at 4°C.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit