Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.
Please call 1-800-766-7000 to place your order or try our site again later.
GDF-9 Mouse anti-Human, FITC, Clone: 53/1, Novus Biologicals
Mouse Monoclonal Antibody
Manufacturer: Novus Biologicals NBP261934F
Description
GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for ELISA, Immunohistochemistry.Specifications
GDF-9 | |
53/1 | |
ELISA, Immunohistochemistry | |
Purified | |
GDF9 | |
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9 | |
Protein A purified | |
Cytokine Research | |
Primary | |
2661 |
ELISA, Immunohistochemistry | |
FITC | |
PBS with 0.05% Sodium Azide | |
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
Mouse | |
IgG1 | |
0.1mL | |
Store at 4°C in the dark. | |
Monoclonal | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title