Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDPD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89


Antigen GDPD1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
25 μg
Each for $106.19
Add to cart
View Documents
Novus Biologicals
100 μg
Each for $352.89
Add to cart


GDPD1 Polyclonal antibody specifically detects GDPD1 in Human samples. It is validated for Western Blot


Western Blot
EC 3.1, FLJ27503, FLJ37451, GDE4MGC35046, Glycerophosphodiester phosphodiesterase 4, glycerophosphodiester phosphodiesterase domain containing 1, glycerophosphodiester phosphodiesterase domain-containing protein 1
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GDPD1 (NP_872375). Peptide sequence IWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDY
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Lipid and Metabolism
PBS buffer, 2% sucrose
Affinity purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit