Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gemin 3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310425100UL
Description
Gemin 3 Polyclonal specifically detects Gemin 3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry.Specifications
Gemin 3 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Component of gems 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, DKFZp434H052, DP103DEAD-box protein DP103, EC 3.6.4.13, Gemin-3, GEMIN3gemin-3, probable ATP-dependent RNA helicase DDX20, SMN-interacting protein | |
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse Gemin 3 (NP_059093). Peptide sequence RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD | |
100 μg | |
Neuroscience | |
11218 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction