Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Gemin 3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31042525UL

 View more versions of this product

Catalog No. NB125752


Add to cart

Description

Description

Gemin 3 Polyclonal antibody specifically detects Gemin 3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

Gemin 3
Unconjugated
PBS buffer, 2% sucrose
Component of gems 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, DKFZp434H052, DP103DEAD-box protein DP103, EC 3.6.4.13, Gemin-3, GEMIN3gemin-3, probable ATP-dependent RNA helicase DDX20, SMN-interacting protein
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse Gemin 3 (NP_059093). Peptide sequence RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD
25 μg
Neuroscience
Primary
11218
Western Blot, Immunohistochemistry
Western Blot 1.0 ug/ml, Immunohistochemistry
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Mouse
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit