Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157621
Description
GFOD1 Polyclonal specifically detects GFOD1 in Human samples. It is validated for Western Blot.Specifications
GFOD1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ADG-90, chromosome 6 open reading frame 114, FLJ20330, hypothetical protein LOC85411, Protein ADG-90, RP11-501I19.1 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 85%; Rabbit: 85%; Zebrafish: 84%. | |
Human, Mouse, Rat, Porcine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9NXC2 | |
GFOD1 | |
Synthetic peptides corresponding to GFOD1(glucose-fructose oxidoreductase domain containing 1) The peptide sequence was selected from the middle region of GFOD1. Peptide sequence NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT. | |
100 μL | |
Lipid and Metabolism | |
54438 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction