Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15762120UL
Description
GFOD1 Polyclonal specifically detects GFOD1 in Human samples. It is validated for Western Blot.Specifications
GFOD1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NXC2 | |
GFOD1 | |
Synthetic peptides corresponding to GFOD1(glucose-fructose oxidoreductase domain containing 1) The peptide sequence was selected from the middle region of GFOD1. Peptide sequence NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT. | |
20 μL | |
Lipid and Metabolism | |
54438 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ADG-90, chromosome 6 open reading frame 114, FLJ20330, hypothetical protein LOC85411, Protein ADG-90, RP11-501I19.1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction