Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GFPT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
| Antigen | GFPT2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15668820
|
Novus Biologicals
NBP15668820UL |
20 μL |
Each for $152.22
|
|
NBP156688
|
Novus Biologicals
NBP156688 |
100 μL |
Each for $436.00
|
|
Description
GFPT2 Polyclonal specifically detects GFPT2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GFPT2 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| D-fructose-6-phosphate amidotransferase 2, FLJ10380, GFAT 2, GFAT2EC 2.6.1.16, glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2, glutamine: fructose-6-phosphate aminotransferase 2, Glutamine:fructose 6 phosphate amidotransferase 2, glutamine-fructose-6-phosphate transaminase 2, Hexosephosphate aminotransferase 2 | |
| GFPT2 | |
| IgG | |
| Affinity Purified | |
| 77 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| O94808 | |
| 9945 | |
| Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title