Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GIMAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GIMAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159488
|
Novus Biologicals
NBP159488 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GIMAP1 Polyclonal specifically detects GIMAP1 in Human samples. It is validated for Western Blot.Specifications
| GIMAP1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8WWP7 | |
| 170575 | |
| Synthetic peptides corresponding to GIMAP1(GTPase, IMAP family member 1) The peptide sequence was selected from the N terminal of GIMAP1. Peptide sequence MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| GTPase IMAP family member 1, GTPase, IMAP family member 1, HIMAP1, IMAP1immunity associated protein 1, IMAP38, Immunity-associated protein 1 | |
| GIMAP1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title