GIMAP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159485

Catalog No. NBP159485

Description

GIMAP5 Polyclonal specifically detects GIMAP5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GIMAP5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ11296, GTPase, IMAP family member 5, hIAN5, HIMAP3, IAN4, IAN4L1IROD, IAN5, IAN-5, IMAP3GTPase IMAP family member 5, immune associated nucleotide 4 like 1, immune associated nucleotide 4 like 1 (mouse), immunity associated protein 3, Immunity-associated nucleotide 4-like 1 protein, Immunity-associated nucleotide 5 protein, Immunity-associated protein 3, inhibitor of radiation- and OA-induced apoptosis, Irod/Ian5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 91%.
• Target Species: Human, Mouse, Rat, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96F15
• Gene Symbols: GIMAP5
• Immunogen: Synthetic peptides corresponding to GIMAP5(GTPase, IMAP family member 5) The peptide sequence was selected from the middle region of GIMAP5 (NP_060854). Peptide sequence CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL.
• Quantity: 100 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 55340
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.