Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GIMAP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GIMAP5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159485
|
Novus Biologicals
NBP159485 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GIMAP5 Polyclonal specifically detects GIMAP5 in Human samples. It is validated for Western Blot.Specifications
| GIMAP5 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ11296, GTPase, IMAP family member 5, hIAN5, HIMAP3, IAN4, IAN4L1IROD, IAN5, IAN-5, IMAP3GTPase IMAP family member 5, immune associated nucleotide 4 like 1, immune associated nucleotide 4 like 1 (mouse), immunity associated protein 3, Immunity-associated nucleotide 4-like 1 protein, Immunity-associated nucleotide 5 protein, Immunity-associated protein 3, inhibitor of radiation- and OA-induced apoptosis, Irod/Ian5 | |
| GIMAP5 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96F15 | |
| 55340 | |
| Synthetic peptides corresponding to GIMAP5(GTPase, IMAP family member 5) The peptide sequence was selected from the middle region of GIMAP5 (NP_060854). Peptide sequence CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title