Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GIMAP6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179618

 View more versions of this product

Catalog No. NBP179618

Add to cart



GIMAP6 Polyclonal antibody specifically detects GIMAP6 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the C terminal of human GIMAP6The immunogen for this antibody is GIMAP6. Peptide sequence GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN.
32 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Dog: 86%; Bovine: 86%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:1000
DKFZp686A01175, FLJ22690, GTPase IMAP family member 6, GTPase, IMAP family member 6, hIAN2, hIAN6, human immune associated nucleotide 2, IAN2, IAN-2, IAN6, IAN-6, immune associated nucleotide 2, immune associated nucleotide 6, Immunity-associated nucleotide 2 protein, Immunity-associated nucleotide 6 protein
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit