Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GIPC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen GIPC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157426
View Documents
Novus Biologicals
NBP157426
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

GIPC1 Polyclonal specifically detects GIPC1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

GIPC1
Polyclonal
Rabbit
Signal Transduction
C19orf3chromosome 19 open reading frame 3, GAIP C-terminus-interacting protein, GIPC PDZ domain containing family, member 1, GIPCRGS-GAIP-interacting protein, GLUT1 C-terminal binding protein, GLUT1CBP, IGF-1 receptor interacting protein 1, MGC15889, MGC3774, NIP, PDZ domain-containing protein GIPC1, regulator of G-protein signalling 19 interacting protein 1, RGS19IP1IIP-1, SEMCAP, SYNECTIIN, SYNECTIN, Tax interaction protein 2, TIP-2RGS19-interacting protein 1
GIPC1
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
O14908
10755
Synthetic peptides corresponding to GIPC1 (GIPC PDZ domain containing family, member 1) The peptide sequence was selected from the N terminal of GIPC1. Peptide sequence SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit