Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLP-1R Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | GLP-1R |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123765
|
Novus Biologicals
NBP309432100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
GLP-1R Polyclonal specifically detects GLP-1R in Mouse samples. It is validated for Western Blot.Specifications
| GLP-1R | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, GPCR, Lipid and Metabolism, Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 2740 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| GLP-1 receptor, GLP-1R, GLP-1-R, glucagon-like peptide 1 receptor, MGC138331 | |
| The immunogen is a synthetic peptide directed towards the middle region of Mouse GLP-1R (NP_067307). Peptide sequence YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV | |
| Affinity purified |
Spot an opportunity for improvement?
missing translation for 'provideContentCorrection'
missing translation for 'provideContentCorrection'
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
missing translation for 'productTitle'