Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLP-2R Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GLP-2R |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159029
|
Novus Biologicals
NBP159029 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GLP-2R Polyclonal specifically detects GLP-2R in Human samples. It is validated for Western Blot.Specifications
| GLP-2R | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, GPCR | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| GLP-2 receptor, GLP-2R, GLP-2-R, glucagon-like peptide 2 receptor | |
| GLP2R | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| O95838 | |
| 9340 | |
| Synthetic peptides corresponding to GLP2R(glucagon-like peptide 2 receptor) The peptide sequence was selected from the N terminal of GLP2R. Peptide sequence KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title