Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLT6D1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | GLT6D1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17931020
|
Novus Biologicals
NBP17931020UL |
20 μL |
Each for $152.22
|
|
NBP179310
|
Novus Biologicals
NBP179310 |
100 μL |
Each for $436.00
|
|
Description
GLT6D1 Polyclonal specifically detects GLT6D1 in Human samples. It is validated for Western Blot.Specifications
| GLT6D1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| galactosyltransferase family 6 domain containing 1, galactosyltransferase family 6 domain-containing 1, glycosyltransferase 6 domain containing 1, glycosyltransferase 6 domain-containing protein 1, GT6M7 | |
| GLT6D1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_892019 | |
| 360203 | |
| Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title