Glucose Transporter GLUT8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159812

Catalog No. NBP159812

Description

Glucose Transporter GLUT8 Polyclonal specifically detects Glucose Transporter GLUT8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Glucose Transporter GLUT8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GLUT-8, GLUT8solute carrier family 2 (facilitated glucose transporter) member 8, GLUTX1facilitated glucose transporter member 8, solute carrier family 2 (facilitated glucose transporter), member 8
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29988
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NY64
• Gene Symbols: SLC2A8
• Immunogen: Synthetic peptides corresponding to SLC2A8 (solute carrier family 2, facilitated glucose transporter, member 8). The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%.
• Target Species: Human, Rabbit
• Isotype: IgG