Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Glucose Transporter GLUT8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen Glucose Transporter GLUT8
Immunogen Synthetic peptides corresponding to SLC2A8(solute carrier family 2 (facilitated glucose transporter), member 8) The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1598220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15981220UL
20 ul Each for $149.00
Add to cart
 
NBP159812 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159812
100 ul Each for $329.00
Add to cart
 
Description

Description

Glucose Transporter GLUT8 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Glucose Transporter GLUT8
Rabbit
Polyclonal
Unconjugated
29988
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to SLC2A8(solute carrier family 2 (facilitated glucose transporter), member 8) The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV
Primary
IgG
GLUT-8, GLUT8solute carrier family 2 (facilitated glucose transporter) member 8, GLUTX1facilitated glucose transporter member 8, solute carrier family 2 (facilitated glucose transporter), member 8
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit