Glutamate Dehydrogenase 2/GLUD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157732

Catalog No. NBP157732

Description

Glutamate Dehydrogenase 2/GLUD2 Polyclonal specifically detects Glutamate Dehydrogenase 2/GLUD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Glutamate Dehydrogenase 2/GLUD2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P49448
• Gene Symbols: GLUD2
• Immunogen: Synthetic peptides corresponding to GLUD2 (glutamate dehydrogenase 2) The peptide sequence was selected from the N terminal of GLUD2)(50ug). Peptide sequence EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.4.1, EC 1.4.1.3, GDH 2, GDH2, GLUDP1, glutamate dehydrogenase 2, glutamate dehydrogenase 2, mitochondrial, glutamate dehydrogenase pseudogene 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2747
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Sheep
• Isotype: IgG