Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glutamate Dehydrogenase 2/GLUD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Glutamate Dehydrogenase 2/GLUD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157732
|
Novus Biologicals
NBP157732 |
100 μL |
Each for $436.00
|
|
NBP15773220
|
Novus Biologicals
NBP15773220UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Glutamate Dehydrogenase 2/GLUD2 Polyclonal specifically detects Glutamate Dehydrogenase 2/GLUD2 in Human samples. It is validated for Western Blot.Specifications
| Glutamate Dehydrogenase 2/GLUD2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.4.1, EC 1.4.1.3, GDH 2, GDH2, GLUDP1, glutamate dehydrogenase 2, glutamate dehydrogenase 2, mitochondrial, glutamate dehydrogenase pseudogene 1 | |
| GLUD2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P49448 | |
| 2747 | |
| Synthetic peptides corresponding to GLUD2 (glutamate dehydrogenase 2) The peptide sequence was selected from the N terminal of GLUD2)(50ug). Peptide sequence EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title