Glutathione S-Transferase pi 1/GSTP1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310136100UL

Catalog No. NB125173

Description

Glutathione S-Transferase pi 1/GSTP1 Polyclonal specifically detects Glutathione S-Transferase pi 1/GSTP1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Glutathione S-Transferase pi 1/GSTP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: deafness, X-linked 7, EC 2.5.1.18, FAEES3, fatty acid ethyl ester synthase III, glutathione S-transferase P, glutathione S-transferase pi 1, GST class-pi, GST3DFN7, GSTP, GSTP1-1, PI
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Glutathione S-Transferase pi 1/GSTP1 (NP_861461.1). Peptide sequence LIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2950
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.