Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Glutathione S-Transferase pi 1/GSTP1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310136100UL

 View more versions of this product

Catalog No. NB125173

Add to cart



Glutathione S-Transferase pi 1/GSTP1 Polyclonal specifically detects Glutathione S-Transferase pi 1/GSTP1 in Mouse samples. It is validated for Western Blot.


Glutathione S-Transferase pi 1/GSTP1
PBS buffer, 2% sucrose
deafness, X-linked 7, EC, FAEES3, fatty acid ethyl ester synthase III, glutathione S-transferase P, glutathione S-transferase pi 1, GST class-pi, GST3DFN7, GSTP, GSTP1-1, PI
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Glutathione S-Transferase pi 1/GSTP1 (NP_861461.1). Peptide sequence LIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1.0 ug/ml
Affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit