Glutathione Synthetase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP257177

Catalog No. NBP257177

Description

Glutathione Synthetase Polyclonal specifically detects Glutathione Synthetase in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Glutathione Synthetase
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Simple Western 1:10, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: EC 6.3.2.3, Glutathione synthase, glutathione synthetase, GSH synthetase, GSHS, GSH-S, MGC14098
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GSS
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPGMLEMLLPG
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 2937
• Target Species: Human
• Isotype: IgG

For Research Use Only