Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLYAT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | GLYAT |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15471420
|
Novus Biologicals
NBP15471420UL |
20 μL |
Each for $152.22
|
|
NBP154714
|
Novus Biologicals
NBP154714 |
100 μL |
Each for $436.00
|
|
Description
GLYAT Polyclonal specifically detects GLYAT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GLYAT | |
| Unconjugated | |
| RUO | |
| Q6IB77 | |
| 10249 | |
| Synthetic peptides corresponding to GLYAT(glycine-N-acyltransferase) The peptide sequence was selected from the N terminal of GLYAT. Peptide sequence HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ACGNATAAc, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, aralkyl-CoA N-acyltransferase, CATEC 2.3.1.13, GATHRP-1(CLP), glycine N-acyltransferase, glycine-N-acyltransferase | |
| GLYAT | |
| IgG | |
| Affinity Purified | |
| 34 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title