GLYATL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154782

Catalog No. NBP154782

Description

GLYATL2 Polyclonal specifically detects GLYATL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GLYATL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Acyl-CoA:glycine N-acyltransferase-like protein 2, BXMAS2-10, EC 2.3.1.13, GATF-B, glycine acyltransferase family-B, glycine N-acyltransferase-like protein 2, glycine-N-acyltransferase-like 2, MGC24009
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 219970
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WU03
• Gene Symbols: GLYATL2
• Immunogen: Synthetic peptides corresponding to GLYATL2(glycine-N-acyltransferase-like 2) The peptide sequence was selected from the middle region of GLYATL2. Peptide sequence LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.