Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLYATL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | GLYATL2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154782
|
Novus Biologicals
NBP154782 |
100 μL |
Each of 1 for $436.00
|
|
Description
GLYATL2 Polyclonal specifically detects GLYATL2 in Human samples. It is validated for Western Blot.Specifications
GLYATL2 | |
Polyclonal | |
Rabbit | |
Human | |
Q8WU03 | |
219970 | |
Synthetic peptides corresponding to GLYATL2(glycine-N-acyltransferase-like 2) The peptide sequence was selected from the middle region of GLYATL2. Peptide sequence LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Acyl-CoA:glycine N-acyltransferase-like protein 2, BXMAS2-10, EC 2.3.1.13, GATF-B, glycine acyltransferase family-B, glycine N-acyltransferase-like protein 2, glycine-N-acyltransferase-like 2, MGC24009 | |
GLYATL2 | |
IgG | |
Affinity Purified | |
34 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title