Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLYATL3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | GLYATL3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179314
|
Novus Biologicals
NBP179314 |
100 μL |
Each for $436.00
|
|
NBP17931420
|
Novus Biologicals
NBP17931420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
GLYATL3 Polyclonal specifically detects GLYATL3 in Human samples. It is validated for Western Blot.Specifications
GLYATL3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
glycine-N-acyltransferase-like 3 | |
GLYATL3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
XP_371825 | |
389396 | |
Synthetic peptide directed towards the N terminal of human C6orf140. Peptide sequence NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title