Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glyoxalase II/HAGH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Glyoxalase II/HAGH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15676020
|
Novus Biologicals
NBP15676020UL |
20 μL |
Each for $152.22
|
|
NBP156760
|
Novus Biologicals
NBP156760 |
100 μL |
Each for $436.00
|
|
Description
Glyoxalase II/HAGH Polyclonal specifically detects Glyoxalase II/HAGH in Human samples. It is validated for Western Blot.Specifications
| Glyoxalase II/HAGH | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q16775 | |
| 3029 | |
| Synthetic peptides corresponding to HAGH(hydroxyacylglutathione hydrolase) The peptide sequence was selected from the C terminal of HAGH. Peptide sequence STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 3.1.2.6, GLO2hydroxyacyl glutathione hydrolase, Glx II, GLXII, Glyoxalase II, HAGH1GLX2, hydroxyacylglutathione hydrolase, hydroxyacylglutathione hydrolase, mitochondrial, hydroxyacylglutathione hydroxylase | |
| HAGH | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title