Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GlyT1/SLC6A9 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$436.00

Specifications

Antigen GlyT1/SLC6A9
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP174187
View Documents
Novus Biologicals
NBP174187
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

GlyT1/SLC6A9 Polyclonal specifically detects GlyT1/SLC6A9 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

GlyT1/SLC6A9
Polyclonal
Rabbit
P28571-1
6536
Synthetic peptides corresponding to the C terminal of Slc6a9. Immunizing peptide sequence FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
DKFZp547A1118, GlyT1, GlyT-1, GLYT1glyT-1, sodium- and chloride-dependent glycine transporter 1, solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Solute carrier family 6 member 9
SLC6A9
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit