Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GlyT1/SLC6A9 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$436.00
Specifications
Antigen | GlyT1/SLC6A9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174187
|
Novus Biologicals
NBP174187 |
100 μL |
Each of 1 for $436.00
|
|
Description
GlyT1/SLC6A9 Polyclonal specifically detects GlyT1/SLC6A9 in Mouse samples. It is validated for Western Blot.Specifications
GlyT1/SLC6A9 | |
Polyclonal | |
Rabbit | |
P28571-1 | |
6536 | |
Synthetic peptides corresponding to the C terminal of Slc6a9. Immunizing peptide sequence FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp547A1118, GlyT1, GlyT-1, GLYT1glyT-1, sodium- and chloride-dependent glycine transporter 1, solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Solute carrier family 6 member 9 | |
SLC6A9 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title