Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gm527 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174246
Description
Gm527 Polyclonal specifically detects Gm527 in Mouse samples. It is validated for Western Blot.Specifications
Gm527 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q4KL13 | |
Gm527 | |
Synthetic peptides corresponding to the C terminal of Gm527. Immunizing peptide sequence: CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYS. | |
Affinity Purified | |
RUO | |
217648 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hypothetical protein LOC217648, MGC117765, predicted gene 527 | |
Rabbit | |
34 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title