Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gm527 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Gm527 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174246
|
Novus Biologicals
NBP174246 |
100 μL |
Each for $436.00
|
|
NBP17424620
|
Novus Biologicals
NBP17424620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Gm527 Polyclonal specifically detects Gm527 in Mouse samples. It is validated for Western Blot.Specifications
| Gm527 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| hypothetical protein LOC217648, MGC117765, predicted gene 527 | |
| Gm527 | |
| IgG | |
| Affinity Purified | |
| 34 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q4KL13 | |
| 217648 | |
| Synthetic peptides corresponding to the C terminal of Gm527. Immunizing peptide sequence: CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title