GNB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP15530720UL

Catalog No. NBP15530720

Description

GNB1 Polyclonal specifically detects GNB1 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: GNB1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P62873
• Gene Symbols: GNB1
• Immunogen: Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2782
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta subunit, signal-transducing proteins GS/GI, G protein, beta-1 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Transducin beta chain 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta-1.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.