Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GO Protein alpha Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309336100UL
Description
GO Protein alpha Polyclonal specifically detects GO Protein alpha in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
GO Protein alpha | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
DKFZp686O0962, G-ALPHA-o, GNAO, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O, guanine nucleotide binding protein, alpha activating polypeptide O, guanine nucleotide-binding protein G(o) subunit alpha | |
The immunogen is a synthetic peptide directed towards the middle region of human GO Protein alpha (NP_620073). Peptide sequence CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL | |
100 μg | |
Signal Transduction | |
2775 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction