Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gonadotropin Inducible Transcription Repressor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310529100UL
Description
Gonadotropin Inducible Transcription Repressor 1 Polyclonal specifically detects Gonadotropin Inducible Transcription Repressor 1 in Human samples. It is validated for Western Blot.Specifications
Gonadotropin Inducible Transcription Repressor 1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
zinc finger protein 213, Zinc finger protein with KRAB and SCAN domains 21, ZKSCAN21CR53Putative transcription factor CR53 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN461. Peptide sequence FRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQC | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
92283 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction