Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPAT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP18436025UL
Description
GPAT2 Polyclonal specifically detects GPAT2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
GPAT2 | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
ALPAAB, BSCL, BSCL1, cancer/testis antigen 123, CT123, EC 2.3.1.15, glycerol-3-phosphate acyltransferase 2, mitochondrial, GPAT-2, xGPAT1 | |
Rabbit | |
Affinity Purified | |
RUO | |
150763 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
GPAT2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction