Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GPR160 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP309486100UL

 View more versions of this product

Catalog No. NB123873


Description

Description

GPR160 Polyclonal antibody specifically detects GPR160 in Human samples. It is validated for Western Blot
Specifications

Specifications

GPR160
Unconjugated
PBS buffer, 2% sucrose
G protein-coupled receptor 160, GPCR150GPCR1, G-protein coupled receptor GPCR1, hGPCR1, probable G-protein coupled receptor 160, putative G protein-coupled receptor
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR160 (NP_055188). Peptide sequence ILTLGMRRKNTCQNFMEYFCISLAFVDLLLLVNISIILYFRDFVLLSIRF
100 μg
GPCR
Primary
26996
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit