Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GPR161 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen GPR161
Immunogen Synthetic peptides corresponding to GPR161(G protein-coupled receptor 161) The peptide sequence was selected from the middle region of GPR161. Peptide sequence FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1602220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16012220UL
20ul Each for $149.00
Add to cart
 
NBP160122 View Documents Novus BiologicalsSupplier Diversity Partner
NBP160122
100 ul Each for $329.00
Add to cart
 
Description

Description

GPR161 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

GPR161
Rabbit
Polyclonal
Unconjugated
23432
Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
RUO
Synthetic peptides corresponding to GPR161(G protein-coupled receptor 161) The peptide sequence was selected from the middle region of GPR161. Peptide sequence FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG.
Primary
IgG
FLJ33952, G protein-coupled receptor 161, G-protein coupled receptor 161, G-protein coupled receptor RE2, RE2
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit