Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPR176 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309730100UL
Description
GPR176 Polyclonal specifically detects GPR176 in Human samples. It is validated for Western Blot.Specifications
GPR176 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
G protein-coupled receptor 176, Gm1012, GPR, HB-954, probable G-protein coupled receptor 176, putative G protein coupled receptor | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR176 (NP_009154). Peptide sequence LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST | |
100 μg | |
GPCR, Signal Transduction, Virology Bacteria and Parasites | |
11245 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction