GPR87 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156442

Catalog No. NBP156442

Description

GPR87 Polyclonal specifically detects GPR87 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GPR87
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: G protein-coupled receptor 87, G protein-coupled receptor 95, GPR95, G-protein coupled receptor 87, G-protein coupled receptor 95, KPG_002, MGC131898, orphan GPCR 87
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 53836
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BY21
• Gene Symbols: GPR87
• Immunogen: Synthetic peptides corresponding to GPR87 (G protein-coupled receptor 87) The peptide sequence was selected from the middle region of GPR87)(50ug). Peptide sequence NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG