GRK7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168989

Catalog No. NBP168989

Description

GRK7 Polyclonal specifically detects GRK7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GRK7
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WTQ7
• Gene Symbols: GRK7
• Immunogen: Synthetic peptides corresponding to GRK7 (G protein-coupled receptor kinase 7) The peptide sequence was selected from the C terminal of GRK7. Peptide sequence FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Rat: 82%; Equine: 79%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 7, GPRK7G protein-coupled receptor kinase GRK7
• Host Species: Rabbit
• Molecular Weight of Antigen: 62 kDa
• Quantity: 100 μL
• Research Discipline: Protein Kinase, Vision
• Gene ID (Entrez): 131890
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.