Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | GRK7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168989
|
Novus Biologicals
NBP168989 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
GRK7 Polyclonal specifically detects GRK7 in Human samples. It is validated for Western Blot.Specifications
GRK7 | |
Polyclonal | |
Rabbit | |
Protein Kinase, Vision | |
EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 7, GPRK7G protein-coupled receptor kinase GRK7 | |
GRK7 | |
IgG | |
62 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8WTQ7 | |
131890 | |
Synthetic peptides corresponding to GRK7 (G protein-coupled receptor kinase 7) The peptide sequence was selected from the C terminal of GRK7. Peptide sequence FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title