Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Growth Hormone 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Growth Hormone 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159327
|
Novus Biologicals
NBP159327 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Growth Hormone 2 Polyclonal specifically detects Growth Hormone 2 in Human samples. It is validated for Western Blot.Specifications
| Growth Hormone 2 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| O14644 | |
| 2689 | |
| Synthetic peptides corresponding to GH2(growth hormone 2) The peptide sequence was selected from the middle region of GH2. Peptide sequence LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| GHL, GHVgrowth hormone variant, GH-VPlacenta-specific growth hormone, growth hormone 2hGH-V, placental-specific growth hormone | |
| GH2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title