Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GRPEL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154665

 View more versions of this product

Catalog No. NBP154665


Add to cart

Description

Description

GRPEL1 Polyclonal antibody specifically detects GRPEL1 in Human, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

GRPEL1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GRPEL1
Synthetic peptides corresponding to GRPEL1(GrpE-like 1, mitochondrial (E. coli)) The peptide sequence was selected from the N terminal of GRPEL1. Peptide sequence NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD.
24 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Pig: 75%; Guinea pig: 75%.
Guinea Pig, Human
Western Blot
Western Blot 1:100-1:2000
Q9HAV7
FLJ25609, GREPEL1, grpE protein homolog 1, mitochondrial, GrpE-like 1, mitochondrial (E. coli), GrpE-like protein cochaperone, HMGEmt-GrpE#1, Mt-GrpE#1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
80273
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit