Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRWD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310088100UL
Description
GRWD1 Polyclonal specifically detects GRWD1 in Human samples. It is validated for Western Blot.Specifications
GRWD1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CDW4, CUL4- and DDB1-associated WDR protein 4, glutamate-rich WD repeat containing 1, GRWDglutamate rich WD repeat protein GRWD, KIAA1942regulator of ribosome biogenesis 1 homolog, RRB1, WD repeat domain 28, WDR28glutamate-rich WD repeat-containing protein 1 | |
The immunogen is a synthetic peptide directed towards the middle region of human GRWD1 (NP_113673.3). Peptide sequence SADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDG | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
83743 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction