Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GSG1 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | GSG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15643520
|
Novus Biologicals
NBP15643520UL |
20 μL |
Each for $152.22
|
|
NBP156435
|
Novus Biologicals
NBP156435 |
100 μL |
Each for $436.00
|
|
Description
GSG1 Polyclonal specifically detects GSG1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| GSG1 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| Q2KHT4 | |
| 83445 | |
| Synthetic peptides corresponding to GSG1(germ cell associated 1) The peptide sequence was selected from the N terminal of GSG1. Peptide sequence NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| germ cell associated 1, germ cell-specific gene 1 protein, MGC111023, MGC3146 | |
| GSG1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title