Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GSTA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153196

 View more versions of this product

Catalog No. NBP153196


Add to cart

Description

Description

GSTA3 Polyclonal antibody specifically detects GSTA3 in Human, Mouse, Sheep samples. It is validated for Western Blot.
Specifications

Specifications

GSTA3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GSTA3
Synthetic peptides corresponding to GSTA3(glutathione S-transferase alpha 3) The peptide sequence was selected from the middle region of GSTA3. Peptide sequence SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR.
25 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse: 79%; Sheep: 77%.
Human, Mouse, Sheep
Western Blot
Western Blot 1:100-1:2000
Q16772
EC 2.5.1.18, glutathione S-alkyltransferase A3, glutathione S-aralkyltransferase A3, glutathione S-aryltransferase A3, glutathione S-transferase A3, Glutathione S-transferase A3-3, glutathione S-transferase alpha 3, GST class-alpha member 3, GSTA3-3, GTA3, MGC22232, S-(hydroxyalkyl)glutathione lyase A3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
2940
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit