GSTA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153196

Catalog No. NBP153196

Description

GSTA3 Polyclonal specifically detects GSTA3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GSTA3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q16772
• Gene Symbols: GSTA3
• Immunogen: Synthetic peptides corresponding to GSTA3(glutathione S-transferase alpha 3) The peptide sequence was selected from the middle region of GSTA3. Peptide sequence SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2940
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.5.1.18, glutathione S-alkyltransferase A3, glutathione S-aralkyltransferase A3, glutathione S-aryltransferase A3, glutathione S-transferase A3, Glutathione S-transferase A3-3, glutathione S-transferase alpha 3, GST class-alpha member 3, GSTA3-3, GTA3, MGC22232, S-(hydroxyalkyl)glutathione lyase A3
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 79%; Sheep: 77%.
• Target Species: Human, Mouse, Sheep
• Isotype: IgG