Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GSTA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $378.35
Specifications
| Antigen | GSTA3 |
|---|---|
| Immunogen | Synthetic peptides corresponding to GSTA3(glutathione S-transferase alpha 3) The peptide sequence was selected from the middle region of GSTA3. Peptide sequence SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15319620
|
Novus Biologicals
NBP15319620UL |
20ul |
Each for $152.22
|
|
NBP153196
|
Novus Biologicals
NBP153196 |
100 ul |
Each for $378.35
|
|
Description
GSTA3 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| GSTA3 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 2940 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to GSTA3(glutathione S-transferase alpha 3) The peptide sequence was selected from the middle region of GSTA3. Peptide sequence SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR. | |
| Primary | |
| IgG | |
| EC 2.5.1.18, glutathione S-alkyltransferase A3, glutathione S-aralkyltransferase A3, glutathione S-aryltransferase A3, glutathione S-transferase A3, Glutathione S-transferase A3-3, glutathione S-transferase alpha 3, GST class-alpha member 3, GSTA3-3, GTA3, MGC22232, S-(hydroxyalkyl)glutathione lyase A3 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title