Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GSTA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen GSTA3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP153196
View Documents
Novus Biologicals
NBP153196
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

GSTA3 Polyclonal specifically detects GSTA3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

GSTA3
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.5.1.18, glutathione S-alkyltransferase A3, glutathione S-aralkyltransferase A3, glutathione S-aryltransferase A3, glutathione S-transferase A3, Glutathione S-transferase A3-3, glutathione S-transferase alpha 3, GST class-alpha member 3, GSTA3-3, GTA3, MGC22232, S-(hydroxyalkyl)glutathione lyase A3
GSTA3
IgG
Affinity Purified
25 kDa
Western Blot
Unconjugated
RUO
Q16772
2940
Synthetic peptides corresponding to GSTA3(glutathione S-transferase alpha 3) The peptide sequence was selected from the middle region of GSTA3. Peptide sequence SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit