GTP binding protein era homolog Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP157433	Novus Biologicals NBP157433	100 μL
NBP15743320	Novus Biologicals NBP15743320UL	20 μL

Description

GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GTP binding protein era homolog
• Classification: Polyclonal
• Host Species: Rabbit
• Gene Accession No.: O75616
• Gene ID (Entrez): 26284
• Immunogen: Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1. Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Alias: CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B
• Gene Symbols: ERAL1
• Isotype: IgG
• Purification Method: Affinity Purified