Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GTPBP10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | GTPBP10 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP152959
|
Novus Biologicals
NBP152959 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
GTPBP10 Polyclonal specifically detects GTPBP10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GTPBP10 | |
| Polyclonal | |
| Rabbit | |
| A4D1E9 | |
| 85865 | |
| Synthetic peptides corresponding to GTPBP10(GTP-binding protein 10 (putative)) The peptide sequence was selected from the middle region of GTPBP10. Peptide sequence IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| DKFZP686A10121, FLJ38242, GTP-binding protein 10, GTP-binding protein 10 (putative), MGC104191, ObgH2, Protein obg homolog 2 | |
| GTPBP10 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title